DPCstruct | MC15145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 65 ± 8 aa |
| Standard deviation of domain lengths | 7.92 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A238XY08 | 8-64 | PRQPITRDEAAQRGLSRFWTGRPCKAGHRAERFVSNRQCVACNAEKARERERLRAAT |
| A0A2J0R2L2 | 1-59 | MKIVTRMEAAKAGLNRFYTGKACRNGHKAERYVLNGTCVECALQSANRHRSEFSSALKS |
| A0A2N3BHP7 | 1-67 | None |
| A0A2T3L3C0 | 1-64 | None |
| A0A7C7C8Z8 | 12-93 | None |
| I4ZUV5 | 3-74 | None |
| A0A1X7AEI9 | 1-62 | None |
| A0A495PQK2 | 18-93 | None |
| B2U8G6 | 12-82 | None |
| A0A5B8IV59 | 21-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.