DPCstruct | MC15144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 145 ± 22 aa |
| Standard deviation of domain lengths | 22.34 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F9QD90 | 4-139 | EELKALLSGILAEHPKLASFEGLSGQTVYHAPDVLSRTYARILDRKGSPLLLMAEEVRANSRDYPRPVPVELFEASPFELTPEEIER… |
| A0A410XAU7 | 65-237 | EQHLANAIRQCSKEGELLAISTLFEAPYSLSVEDIAQLKIALNGDEFIDIAHLSLNEQDYFYSTDFMSDNYAQLQLLNRHADICTAI… |
| A0A6N6NQJ1 | 353-477 | None |
| A0A7C9NRS0 | 249-392 | None |
| A0A423UMI0 | 47-180 | None |
| A0A6M8J963 | 557-679 | None |
| A0A227KHW1 | 117-264 | None |
| A0A4T9T9B6 | 433-555 | None |
| A0A5C1MAT3 | 140-318 | None |
| A0LH73 | 1-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.