DPCstruct | MC15143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Standard deviation of domain lengths | 11.72 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 94.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 33.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8UJ17 | 14-105 | RRRGIFYDTDMIQEHQEETVRLCPHCPGFVTLSSKAEQSGRRLPSAYCVSIPIQACPECVRAGMGAFDRERRSPRHDLVLLQDRPGD… |
| A0A1F9Q7R7 | 2-89 | RHKNIYYDTDDITEAQTEELFLCGSCRGLLKVVSRTTKNPACLGIEIPLHACDACRSLGYSIYEEAQVKEGYRFAQFINRRDKEYSRH |
| A0A1V5JPE7 | 115-216 | None |
| A0A257M8K3 | 308-409 | None |
| A0A101FFM9 | 333-450 | None |
| K1YBE3 | 238-339 | None |
| A0A7C1DUN2 | 184-270 | None |
| A0A7X6YR22 | 2-72 | None |
| A0A4Q2WDZ2 | 44-152 | None |
| A0A4R6LVC7 | 412-501 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.