DPCstruct | MC15139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 612 ± 127 aa |
| Standard deviation of domain lengths | 127.16 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 74.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.18 |
| Pfam Score | 85.68 |
| Assigned Pfam label(s) | PF08170- PF06978 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4YII4 | 134-687 | ARFVKVYNYLEERAAQVADLLQVVDNSDLVSGEVTKGPRTAAQRLPRHMRRRAMAYEVRRFPRGLRSFVAPFLASSKHRKKPPSRFF… |
| A0A226EGV8 | 1-664 | MEVDETVESLGVRNFLAARIQEINSLSNQISTSGIPASKGLAFQHVPKHMRRRAVSHNPKRLPKRLQGIHRHQVEKSSGSSVIKKAK… |
| A0A4X3PVA9 | 163-898 | None |
| A0A061DBK3 | 12-556 | None |
| A0A3F2RXZ2 | 288-1050 | None |
| A0A175W6B4 | 67-883 | None |
| A0A1Q5Q9Y5 | 392-1203 | None |
| A0A4Y9ZN33 | 36-567 | None |
| A0A816CNH3 | 232-850 | None |
| A0A4Y9Y9P2 | 3-570 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.