DPCstruct | MC15138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 440 |
|---|---|
| Mean domain length (aa) | 192 ± 33 aa |
| Standard deviation of domain lengths | 33.08 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 11.92 |
| Pfam Score | 66.62 |
| Assigned Pfam label(s) | CL0648- PF14613- CL0027- PF19343- PF14356 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226EFI4 | 19-215 | SKRDTKIKQPVLQLNGTTLTDKVMDSVRAEVIKQGWDDINPPDVVLKDPFGFSNYSLAIRNQSIKGMANAYRVGDVIVNVTILNTKF… |
| A0A2A4JLY9 | 29-226 | CKWDDSKCIKGSAQSAIPILAAGIPELGVEKLDPFYMKSLDASSNGLNLQLWDIKGTGLSGCVAKKMQRDINKSKLIVKLQCSVDFV… |
| A0A3Q0JFJ1 | 299-499 | None |
| A0A182TTJ6 | 3-161 | None |
| A0A182U5A7 | 1-158 | None |
| A0A7R9NYC6 | 5-146 | None |
| A0A834XI77 | 35-223 | None |
| A0A370PJ13 | 110-331 | None |
| A0A3Q0JFG3 | 2-153 | None |
| A0A834Y7P7 | 40-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.