DPCstruct | MC15132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 114 ± 7 aa |
| Standard deviation of domain lengths | 6.66 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182SGF2 | 34-152 | TLPGCVNGCSRHGQCTMEDGEYKCICVEGWAGNDCSIALEMSCKDNIDNDNDGMTDCSDSECCVHPICAEHIMCLASNDPVEVLLRK… |
| A0A226E7A4 | 1-103 | MQDNRYLCKCSNSWAGEDCSIRLETNCSDDIDNDDDGMSDCSDSECCDDQKCKDHLMCMTASDPVEVLLRKQPPSVTSSFFQRVKFL… |
| A0A6I9Q5G0 | 105-216 | None |
| A0A4Y2CQ81 | 141-261 | None |
| A0A498ML65 | 659-762 | None |
| A0A2R7VZ62 | 109-227 | None |
| A0A1I8GZQ9 | 66-177 | None |
| T1KG44 | 845-966 | None |
| A0A817YU79 | 688-800 | None |
| A0A182W1Z3 | 261-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.