DPCstruct | MC15130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 126 ± 17 aa |
| Standard deviation of domain lengths | 17.09 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.99 |
| Pfam Score | 91.76 |
| Assigned Pfam label(s) | CL0759- PF01798- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226DY28 | 7-137 | HLLFEHASGFGIFKIREFEEENMFMAEVEECIRDFSRFSAIASHVAFSPFKTAQAALVNLNSVTEGVLADDLKNFLSTLGIKNLVLG… |
| A0A5J9UZD9 | 24-156 | LGHHGIILVLLETPSGFAIFSLNGVKLYLPDAMGNIWSNFLHEYDANKFVRMKEFRTFEDKSNAILGTGINRQLTEMIMKWRRRGQK… |
| A0A0D3D8H9 | 49-144 | None |
| A0A0E0MA42 | 230-376 | None |
| A0A0N4VWQ0 | 37-162 | None |
| M7YL80 | 14-139 | None |
| A0A1B7MHQ3 | 2-144 | None |
| A0A814S790 | 270-412 | None |
| A0A821HWF0 | 1-104 | None |
| U6LSG6 | 5-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.