DPCstruct | MC15129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 141 ± 30 aa |
| Standard deviation of domain lengths | 29.67 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A016SXU4 | 5-108 | ALHVRQGDPSALAFGISPLNAWIRSMECLLHIAYRLDVKKWAIRSDEDKKKVELRKKRIQKEFCEEVGLRIDVPRRASGNSNDGNTA… |
| A0A226DWI7 | 375-515 | NFTVIDGKVLSIITRTPSQQSCPICCANPSQFNKIDLPFEAKQERLKFGISPLHCWIPALEFCLKLGYRNIEGLRCSRVDGVIKKQI… |
| A0A4C1TFX3 | 10-125 | None |
| A0A2W1BF04 | 320-454 | None |
| A0A4Y2URE7 | 230-364 | None |
| A0A4C1TYL0 | 72-208 | None |
| A0A4Y2D5V2 | 35-175 | None |
| A0A0J7KQY6 | 3-136 | None |
| A0A4C1XTR5 | 96-247 | None |
| A0A0J7KG68 | 4-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.