DPCstruct | MC15128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 110 ± 21 aa |
| Standard deviation of domain lengths | 21.07 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.70 |
| Pfam Score | 98.75 |
| Assigned Pfam label(s) | CL0010- CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7IWE8 | 3-118 | AELKMVLESFRRQRPHLEIVKTPDVFINQKSSPQEVQAWLKDKGFSKRIMKQFEGVDGEKMFTLNKNKIEEYCGAREGARLYSQITV… |
| A0A226DQY2 | 121-268 | PPSGQRLTPQPMSPNTKKPRDDMMQQELRTVLTLFREKREKIEIHKTPEVYINQHSSVEEVQEWLKVKGFSDPIRKQLSNMNGTELF… |
| A0A131XDG2 | 977-1097 | None |
| A0A2T7NJ41 | 31-150 | None |
| A0A4W5KGQ3 | 1-78 | None |
| A0A4W5KLA7 | 1-78 | None |
| A0A7J7Z2A3 | 250-377 | None |
| A0A139WNW3 | 5-104 | None |
| A0A7J6BED6 | 1147-1214 | None |
| A0A4Y2UHF7 | 48-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.