DPCstruct | MC15125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 77 ± 12 aa |
| Standard deviation of domain lengths | 12.11 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 57.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01139 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R3KY54 | 224-321 | MNLAGDYASACHDDIHRRLVKAVGGRVKSRIENHHNFAWKEIHNGKEVIVHRKGATPANENELGMIPGSMTAKGFIVRGKGNPDSLN… |
| A0A0G4EDZ8 | 408-483 | IHHNYCTCETCTYTDPHTGEKRTEDLYVTRKGATSAKAGELGIIPGSMGTGTYIVEGKGNSLSWQSCSHGAGRRMS |
| A0A813G923 | 475-553 | None |
| A0A812JCU4 | 878-953 | None |
| A0A1C3NJ56 | 535-606 | None |
| A0A1C5ICL8 | 614-678 | None |
| A0A1U7P248 | 622-712 | None |
| A0A6N6TCG5 | 217-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.