DPCstruct | MC15122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 52 ± 3 aa |
| Standard deviation of domain lengths | 2.62 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 53.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T8QSJ7 | 1-48 | MRWSSEECTFAVEAYFSNRQSVVATQRAFRNRFNVAPRGPVPDRKLIV |
| A0A7T8HL68 | 1-48 | MRWSSEERTFAVEAYFSNRQSIVATQRTFRNGFNVAPRGPVPDRKSIV |
| J9LID0 | 3-55 | None |
| A0A812B6W2 | 1-54 | None |
| A0A1B6HQS9 | 1-54 | None |
| A0A6G0YAU3 | 1-54 | None |
| A0A6P3X0M1 | 2-55 | None |
| A0A812CK52 | 1-50 | None |
| A0A812E4D6 | 1-55 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.