DPCstruct | MC15121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 120 ± 10 aa |
| Standard deviation of domain lengths | 9.67 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 47.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04675 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T8HHA0 | 1-126 | MLEDLEAGDIAATISSFYEKNGCIPPLKKSCLNVFEVNDFLDGLVGITTEDKQMFELKKMTKKCTVEDLNFLIRLIKGDLRMQAGSK… |
| A0A0T6BB94 | 231-345 | LEHLGGGDVSETIQHFFTLSKTCKPASKSLLTLDIVDDFLEELAKLTKEEERIQHFKKIVSQCTPNDLKIIIRLIKGDLKMNAGAKH… |
| A0A834IMD5 | 216-333 | None |
| A0A7J7J531 | 271-392 | None |
| A0A817HNR7 | 1-123 | None |
| A0A7J5ZRK3 | 176-298 | None |
| A0A177BC63 | 463-583 | None |
| A0A834DY95 | 1-128 | None |
| A0A7R9FN14 | 451-564 | None |
| A0A673GQH1 | 271-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.