DPCstruct | MC15120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 7.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 59.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8CLB7 | 1-94 | METIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRT… |
| A0A7T8HES1 | 1-80 | MKLDPSIYESLQKERVEVGDVIYIEANSGAIKRQGRSDTFATEFDLEAEEYVPIPKGDVHKRKEVIQDVTLHDLDAANAR |
| X6P942 | 77-171 | None |
| A0A0V0WVN6 | 203-299 | None |
| H3DSG7 | 127-206 | None |
| A0A0K0DJH0 | 167-246 | None |
| A0A1S3X6P9 | 240-322 | None |
| A0A7J9J751 | 97-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.