DPCstruct | MC1512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 97 ± 13 aa |
| Standard deviation of domain lengths | 12.57 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 25.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0123- PF12472 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5T3V8 | 1-91 | MDMNEVIDRAIQRANLRTDYELSKATGIPQNILSAIRKGKRNPSTTETTQLATLAGLDEMTIIGELEMRTAKTEKKREFWRQFLEAR… |
| A0A246IVP3 | 2-87 | LSTNELLDLARERAGNVTDYRVAKLVGINPNAMYNYRKGLSIPESPVAMRLAEVAGVDPAVAVFALNVARARTEEEREFWSAQLRR |
| A0A4P6H359 | 2-74 | None |
| Z9JJD0 | 30-118 | None |
| A0A7C4E5K6 | 2-91 | None |
| A0A6L4BFS3 | 37-144 | None |
| A0A562IZ06 | 1-105 | None |
| A0A370XCG5 | 170-272 | None |
| A0A2D4TES1 | 1-90 | None |
| A0A2S5TA09 | 1-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.