DPCstruct | MC15117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 126 ± 13 aa |
| Standard deviation of domain lengths | 12.81 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 43.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3N9J4 | 348-471 | TMSPSPCNFTTSGANTGKVIGEPNTALLSFVLMAGTYFIAFYLRKFKNSSFFPGKLRRSIGDFGVPIAILIMVLVDYSVEDTYTQKL… |
| A0A1S3QRI5 | 1-127 | PLNATWSSLSKKECLKYGGELVGKACKYVPDITLISFILFLGTYTTSMMLKKFKTSPFFPTWVRKLISDFAIILAILIFCGVDMLVG… |
| A0A814LIZ2 | 504-628 | None |
| A0A4U5P8U1 | 61-179 | None |
| A0A6I9Z059 | 20-143 | None |
| S4R7C1 | 186-326 | None |
| A0A077ZEC9 | 7-121 | None |
| A0A821Z484 | 16-166 | None |
| A0A060YD71 | 236-371 | None |
| A0A183D2J9 | 3-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.