DPCstruct | MC15115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 91 ± 12 aa |
| Standard deviation of domain lengths | 12.20 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 57.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09744 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1FZZ9 | 1-73 | MSDRVQAVATNIYREFERMIPTYGEDVVKDMMPHIVTILESLDSAFKENQEKEAELELCKDDNEQLMSQYERE |
| A0A7T8GWP6 | 13-107 | LGLPEDSEYMREQSHGNGNQAVMNEKVQSLAGSIYEEFESMILRYDTDVVKSLMPLIVNVLESLDLSYTEIQEYEVELELLKEDNEQ… |
| V4CPR0 | 1-73 | None |
| A0A6J8DIE1 | 1-103 | None |
| A0A183VFS0 | 5-98 | None |
| Q4S9X0 | 1-91 | None |
| A0A1I8JJ40 | 11-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.