DPCstruct | MC15114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 116 ± 14 aa |
| Standard deviation of domain lengths | 14.34 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.83 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822I1G6 | 1-115 | MMKEHERREYLKSLDEDKRRMEEAHYEEMKKKHREHPKVNVPGSKDQLKEVWEETDGLDPNDFNPKTFFKLHDTNGDGVLDEQELEA… |
| A0A7T8GUI8 | 1-119 | MEKKFEKESRLRHIEKEEDREKERMKLDGPRVRHKKHDKVNHPMTKDQLEEVWEEQDHMRAEDWDPKTFFAMHDLNGDKQWDENELK… |
| A0A1D2NKG0 | 183-315 | None |
| A0A6B0RSQ9 | 180-288 | None |
| A0A4U8UX50 | 182-285 | None |
| A0A0A9YPC7 | 60-194 | None |
| A0A7J7IUQ8 | 183-290 | None |
| A0A7R8CPY0 | 181-286 | None |
| H3C7I4 | 110-221 | None |
| A0A6A4VAL5 | 176-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.