DPCstruct | MC15112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 140 ± 17 aa |
| Standard deviation of domain lengths | 17.02 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.99 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0407- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151FAG9 | 1-136 | MRSISLSQKEIGNLIREVARRTLNRIPVTNQYEFIRVKDGDIFFILHNTGKIVFQESKGFDSFLDDILVREDHSIIGTDEVGKGEWY… |
| A0A2X3GYG7 | 8-129 | ANTVIQASNGQLTEMKQAYTPYIQPKLPPGALFSAKKGSITITAYKSGKVMFQGAGSELEASKWGNSLQKSTPSMAKHTLPDGFQTK… |
| B7JR61 | 3-140 | None |
| A0A3L7TLF2 | 9-165 | None |
| A0A497Q6J1 | 43-184 | None |
| A0A6M2A7L8 | 1-151 | None |
| A0A091CCN8 | 1-145 | None |
| A0A2V8AQI2 | 405-573 | None |
| A0A6A4UN59 | 2-114 | None |
| B5YD21 | 3-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.