DPCstruct | MC15110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 99 ± 8 aa |
| Standard deviation of domain lengths | 8.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 31.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U2E4S5 | 1-100 | MAKIRPIKRSFNAGILSPVMYGQVDFDKWASAVKRMKNFIPLPQGPARRRGGTQYVGSVKESTQRVWLSSFQFSTTEAFILEFGPEY… |
| A0A0N0M2F4 | 1-96 | MAGLRKLITAFLAGEIDPMMHGRVETDHYAYGLTTCENFVPTNEGPIVKRPGFEYICDADPSSTWLGAFRFSITQEYLIEWGELKAR… |
| A0A2D8J5G8 | 1-99 | None |
| A0A843GWM4 | 1-110 | None |
| A0A4R6FQB1 | 1-99 | None |
| A0A0F8YWX0 | 1-97 | None |
| Q2T025 | 1-100 | None |
| A0A7V8DGM6 | 1-93 | None |
| A0A2A4PQQ6 | 1-89 | None |
| A0A1G0DWL8 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.