DPCstruct | MC1511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 95 ± 10 aa |
| Standard deviation of domain lengths | 10.18 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q4BRW7 | 24-109 | KPKPKPRMVVCAAILVKGSIHIGPRHFDQTMIRHMVSLGEIPEQGFIDQWGVFMTREEAWQVAEAAGQIKYRVGGDGKELFSENLY |
| A0A5C7JL33 | 2-110 | DKEYIICAANYYNDGKVHVHQPTNVEIGFVVGGRRHHNCIHTFTLIVGYPYDENGLEIRRTEVQGFLTNTNRFVGRKEAYKIAFEAE… |
| A0A316S3C4 | 8-109 | None |
| A0A4V2A487 | 19-128 | None |
| A0A1V5NWM7 | 85-170 | None |
| A0A7X6GK19 | 57-151 | None |
| A0A1V5X084 | 2-89 | None |
| A0A0B8WJP5 | 1-83 | None |
| A0A2M9X350 | 63-154 | None |
| A0A515KK81 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.