DPCstruct | MC15109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 151 ± 16 aa |
| Standard deviation of domain lengths | 16.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S8CKF7 | 3-143 | SAATDSSVSFADTGLEPVTDIWHISTLQDDLEHLQDAAFRLAFELAEVLQVEQALCEDNAPTSAGYRIQINLHQASPITRLLAALTG… |
| A0A7U1FED2 | 25-165 | GAFQTSVSSIAFAAAGLEPVADIWHIPSLQDDIEHLQDMAFRLAFELAEALEIGELVIEDKSPLSSGFRIIDEPMYSAHSGRQLLSL… |
| Q9PCJ6 | 146-297 | None |
| A0A4C9BBG8 | 155-306 | None |
| A0A6D2GFP4 | 102-263 | None |
| A0A376W891 | 150-310 | None |
| A0A6H0JJ33 | 224-384 | None |
| A0A1B8YF78 | 76-244 | None |
| A0A378MYL0 | 41-164 | None |
| A0A658KDT8 | 267-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.