DPCstruct | MC15108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 229 ± 39 aa |
| Standard deviation of domain lengths | 39.23 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U0L046 | 35-255 | IIKGVIKTAAPIVYMILVALFCIGLTLSIWLPFVPFIYWFVAMADWLVTLLTGIVASSLWAATHINIGQTNEDRSTYGYIFLIDVMI… |
| A0A5E4XLU1 | 11-188 | GLGLSTYLPMVPFVIWFGAAVNWLVVVGEGVIAAPLWAITHLGGEGDGLGHKTAHGYIFLLEMMVRPILMVIGFFLGGAGIVAGGTL… |
| A0A1E7I3E5 | 3-198 | None |
| A0A223DR26 | 430-649 | None |
| A0A2D8K6W7 | 6-198 | None |
| A0A759NU34 | 196-362 | None |
| A0A1J4RN26 | 475-724 | None |
| A0A0M0EE32 | 108-333 | None |
| A0A5K1NIX6 | 473-779 | None |
| A0A072TDS4 | 157-379 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.