DPCstruct | MC15103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 116 ± 22 aa |
| Standard deviation of domain lengths | 21.50 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0529 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496UH86 | 133-256 | SIDSRIDSVLTSLPEEHPQGPVIELPQPRLSSDVSVEEAMQNRRSIRFYEDSPLTITEVSQLLWSAYGLSYPVENAPDFLRGGLRTA… |
| A0A7U4NDM1 | 8-129 | TAEGMVDRLGAPPAEVVERGVGGVAARTTLPLAPSGTFDELLSRRVTCRNFDTQRALSGGLLSHMLQRSVMASARVAVGHDTAFLKK… |
| A0A845WHC8 | 713-821 | None |
| A0A2Z6GC87 | 1-145 | None |
| A0A1G6Q1I3 | 189-292 | None |
| A0A5C8KME0 | 144-273 | None |
| A0A843BVU3 | 9-110 | None |
| A0A1C2J1B9 | 1-136 | None |
| A0A371PEA5 | 243-341 | None |
| A0A8A6PR09 | 15-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.