DPCstruct | MC1510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 57 ± 6 aa |
| Standard deviation of domain lengths | 6.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0045 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E6KPN3 | 2-50 | IINIKSNQLPLHCPLPGENLWNQHPKIYLPIDSVKKIKCPYCGTEYVLE |
| A0A1J5RDL3 | 4-58 | VGTPVVYLSASDLPAFCPNPSMPLWASHPRIFLDVVNESEAMCPYCGTRYRLKRD |
| A0A7V7WSA9 | 4-58 | None |
| A0A060H2J6 | 30-94 | None |
| A0A849TBN3 | 1-51 | None |
| A0A2D9R066 | 6-62 | None |
| A0A2A4U084 | 3-56 | None |
| A0A2E6E6S5 | 3-44 | None |
| A0A1V3NYB4 | 1-48 | None |
| A0A3E1KD40 | 10-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.