DPCstruct | MC151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 166 ± 19 aa |
| Standard deviation of domain lengths | 19.25 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0YRR5 | 88-245 | VATAIVRAIGLYIPNLLLDLNDIISIDFGAGPEVCVEARITRYLQWGGAYGEKYFLAKGYDRQIGGGYTNGWNYEDTMLSMESRYVE… |
| A0A4R9GL64 | 109-260 | LLAKFAWYLPDRILDLLDILSVNVKVGPQFGVSAWVTRGFQVTLYTGNTVQLGWFQKRNLGYTEELSAEAGLGPVVPISISGRSMGT… |
| A0A7V3AHT7 | 47-219 | None |
| A0A7V2X959 | 13-189 | None |
| A0A7C3F3T4 | 15-177 | None |
| A0A7C3II15 | 28-196 | None |
| A0A1G0YDK9 | 207-366 | None |
| A0A7C3IXQ3 | 2-168 | None |
| A0A7C3J310 | 18-191 | None |
| A0A0S8FIJ8 | 8-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.