DPCstruct | MC15099
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 138 ± 14 aa |
| Standard deviation of domain lengths | 14.06 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.67 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0123- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831NJU0 | 11-150 | EQETEIIEKEEASNVRGDEIKALARIRVCSVCGEELFDEELEEGNIKKVYDIYRKKHGILLPEEIRNIRESYGLSQRAFAKLLGIGE… |
| A0A846T7K1 | 5-148 | KCANCGASELQFLTEAETFIYKGQSLTVDVDYSVCAQCGTEVILTEQIKRNDCRLRDAWRKADGLLSGAEISALRKKLALTQQEAAK… |
| A0A350ASU8 | 12-147 | None |
| A0A1G1SQF7 | 2-135 | None |
| A0A3S2XLG7 | 6-142 | None |
| A0A1G6EH06 | 6-124 | None |
| A0A2S2CSV2 | 24-130 | None |
| A0A850TEH1 | 1-144 | None |
| A0A2M8BV19 | 5-123 | None |
| A0A1G1EA11 | 3-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.