DPCstruct | MC15098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 195 ± 1 aa |
| Standard deviation of domain lengths | 1.36 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 93.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7YVW9 | 526-722 | LCNLSSQQGLFRTLDGLSRLTGEPRYRDAAIEALRYAFDHLRYGIEHNGGLLAWGGHLAYNATDDVLAGNPDGSGRIHELKCFFPHY… |
| A0A532UMZ8 | 635-828 | LSNFASQQPLIRILDGLSTLTADSKYRRAAADATGHVLQHLQSDNGLLYWGGHLAWDLQTDRPVGQYAGAHEMKGHQPYYSFMWKVD… |
| A0A5Q4H5F4 | 236-430 | None |
| A0A496ABQ2 | 82-275 | None |
| A0A2E3IHK5 | 68-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.