DPCstruct | MC15095
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 162 ± 26 aa |
| Standard deviation of domain lengths | 25.53 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0053 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P9GYJ2 | 20-178 | SLRCRWLDHKFKQFSDTSLDLLEKMVNNATNSTEVDFPHHLYRQASEESAENQVAFTVQVLKEVSALFEEEDSSSSSWQQITVEKFL… |
| A0A452RJW5 | 6-158 | RNHGLFAWRALTLLGQMKRMSASSCDGYTHDFAFPKEVVDGKQLQKAQALSVVHVMNQKIFHVFCTEPSSAAWNTTLLEEFCSGLSE… |
| A0A821Z1I1 | 3-136 | None |
| A0A3Q7XGY8 | 92-246 | None |
| A0A3B3D1K0 | 1-179 | None |
| A0A7R8C3K6 | 17-190 | None |
| A0A3Q7REK8 | 20-184 | None |
| A0A835NDW1 | 88-274 | None |
| A0A7R8C365 | 2-157 | None |
| A0A7R8C3W0 | 52-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.