DPCstruct | MC15093
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 101 ± 5 aa |
| Standard deviation of domain lengths | 5.46 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 61.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820BS54 | 9-109 | QAEGVIKNIIREIVQECASRGEGVSETLVAFIVKAVVLEPQNDFQVDRVLASDDVKRLIDLCVRRLLDNKSSSLDTIKMQVYFDMNY… |
| A0A452RD18 | 1-106 | MPPTQAESVIKNIIREIGQECAGHGEIVSETLAAFMVKAVVLDPSNGFNMDRTLMKSDVQKLVKLCVSRLLDSKNPSLDTIKMQVYF… |
| A0A5K4FBE0 | 1-104 | None |
| A0A401S9S8 | 1-103 | None |
| A0A1Z9KZT4 | 2-95 | None |
| A0A3B3YJG0 | 1-100 | None |
| M7CMW6 | 364-464 | None |
| A0A672GDE8 | 1-102 | None |
| A0A3Q3FZY1 | 1-89 | None |
| A0A6J1Z6F5 | 8-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.