DPCstruct | MC15092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 314 ± 79 aa |
| Standard deviation of domain lengths | 78.93 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 73.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452RAI0 | 6-310 | LPSARWLYCGEPDESQRAVLVQFSNGKLQNPGNMRFTLYKSNDSTNPRKKSQRILAAETDRLSYVGNNFGTGALKCNTLCRHFVGVL… |
| A0A383V9N7 | 217-596 | FALGAAGLGEADEQQLGFQAYAADPAKESHPMYLVSRLPGANLIATTEMPVQSATDKAHYVVGIRNKRTGQLRLAEAAGGSLLRLEA… |
| A0A1D1WA92 | 168-605 | None |
| A0A834Y1W6 | 4-262 | None |
| A0A2U3VCQ9 | 3-339 | None |
| A0A139WFB4 | 16-311 | None |
| A0A2H3ELX9 | 1-159 | None |
| A0A6V2QRL2 | 45-600 | None |
| A0A0R3QA37 | 1-252 | None |
| A0A6L5C6L0 | 47-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.