DPCstruct | MC15090
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 136 ± 18 aa |
| Standard deviation of domain lengths | 18.18 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.81 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | CL0126- PF16491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A388P2L9 | 5-152 | ALVVIVLAAYIIESILDNLNLSTARNALDPKIAHLYDAKERERSISYSAEKTRFGFISSTISTLILIFALSYGWFASLDNWARGIVD… |
| A0A5C7I2X3 | 1-109 | MIVMYFFETYLDLRQHAAHKQPILPKTLEGVISQEKFEKARAYSLDKSHLHFLHEFVTVVMNSAILLFRILPWFWKKSGSFLVLVGL… |
| A0A7R9AKV7 | 104-220 | None |
| A0A1R3H290 | 233-348 | None |
| A0A6A6MNB9 | 1-126 | None |
| A0A101GFS6 | 5-139 | None |
| A0A453PA43 | 82-201 | None |
| A0A6V7PXC4 | 17-126 | None |
| A0A7J6UF64 | 153-272 | None |
| A0A6P4MJF4 | 16-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.