DPCstruct | MC1509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 123 ± 9 aa |
| Standard deviation of domain lengths | 9.23 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9NJJ7 | 16-144 | LDLDEVEVALLNAAVGDYAAEAAVLLLANDGYWPAHLPAAGMITVEAEPVGGQMWARIEWAELDAALADGRLPGSPEELAVLRVAVS… |
| A0A1J5QYY6 | 6-148 | TSSTRQAITDRLRTWAAGSHPLTAAVELLIRAFDGRFADAGQPWIRIEDNGWVWLDDKILHANLGRLSGGERRVLDLVCALVDPDRA… |
| A0A2Z5K4Y2 | 107-233 | None |
| A0A0M8YKS1 | 1-128 | None |
| A0A2W1U7U2 | 5-125 | None |
| A0A4R4SW77 | 10-133 | None |
| A0A0M8XRX8 | 118-238 | None |
| A0A1M6QIT7 | 3-133 | None |
| A0A2A3HT03 | 4-117 | None |
| Q5YMQ3 | 5-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.