DPCstruct | MC15089
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 105 ± 9 aa |
| Standard deviation of domain lengths | 9.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0482 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4FIK7 | 5-92 | QAIPGLFPPGLVPIDLVKCWSSLFTVQGCVLAISNSFFSGKFENVEAACCKVFSTLDANCWPHMFPLNPFFPPLLKDNCSRIIPNSPA |
| A0A5C7HYI1 | 3-108 | QTNVNFSIALILACVFMVIAPGSAAEPSTEFTALFGQDPDVLQCLSTLQSVQGCVQEITTSFLSHQVQLLGTACCKALNEVDDRFCW… |
| B9RBY2 | 81-171 | None |
| A0A7J7DSP3 | 32-143 | None |
| A0A834Z6Z2 | 6-106 | None |
| A0A834ZRA3 | 5-104 | None |
| A0A6P5ZHG1 | 9-130 | None |
| A0A7J7MZ04 | 90-178 | None |
| A0A7J7L851 | 21-122 | None |
| A0A834HKG3 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.