DPCstruct | MC15087
Metacluster Properties and Pfam Annotations
| Number of structural domains | 99 |
|---|---|
| Mean domain length (aa) | 180 ± 29 aa |
| Standard deviation of domain lengths | 29.07 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 33.56 |
| Pfam Score | 99.29 |
| Assigned Pfam label(s) | PF01201- PF15251 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7HQB0 | 33-211 | QELGLIRMKQRAKRPKSAIMKPKSQLLFIVHIQGAHGGNVKWHALRLDTGNYSWGSEAVTRKTRILDVVYNTSNNELVRTQTLVKSA… |
| A0A2I3G5R5 | 2-172 | GISRENWHKRRKTGGKRKPYHKKRKYELGRPAANTKIGPCHIHTVRVRGGNKKYCALRLDVGNFSWGSECCTRKIRIIDVVYNASNN… |
| A0A5N7D180 | 20-201 | None |
| A0A3Q0IVQ7 | 6-140 | None |
| A0A3Q0J059 | 40-166 | None |
| A0A5D2SYG6 | 2-137 | None |
| A0A7J0G2K5 | 159-338 | None |
| A0A834SR19 | 200-408 | None |
| A0A068UZD1 | 41-174 | None |
| A0A821CI34 | 5-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.