DPCstruct | MC15082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 170 ± 33 aa |
| Standard deviation of domain lengths | 32.75 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01395 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D2IYR1 | 7-126 | PGSGTPPTAEERAARKIAHECADECLYKSSNLLTSAGELDKDAIKALVTKLYTGDWATAATTAIDKCLASAKGEVEATSKCKSGSFQ… |
| B0WQ01 | 12-168 | GVSFEVTVNGEDCIDTKTQAKEISECCDMHNPIDLSVAEECVEKYKDLSGEELIACIYECVGDKTGVIQGTTVSKDKLLENANKVPD… |
| A0A2P8Y2W5 | 3-146 | None |
| A0A6G6C234 | 6-146 | None |
| A0A0M4EV85 | 122-302 | None |
| A0A0P0UVY8 | 16-213 | None |
| A0A2P8XWL5 | 19-164 | None |
| A0A4C1TZ62 | 15-143 | None |
| A0A0X8DCA9 | 22-190 | None |
| A0A0X8DC74 | 25-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.