DPCstruct | MC15081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 85 ± 17 aa |
| Standard deviation of domain lengths | 16.53 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 45.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0056 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4AY79 | 197-256 | RDSAWPEKMVWHGSSKKGHRQMDHYCETWRAGEHAVTGLASSLQSGRLLQQMPSSCSGSY |
| B0WFL6 | 54-156 | VVAHLSGPQKLVWHGSSTLGERTMDTYCDAWHSSAPDKVGTASSLLGNKLLDQERYSCDNRFVVLCIEAVSQDRRRKRDVRSHREFA… |
| A0A1A9W391 | 23-98 | None |
| A0A4U5U2L3 | 1026-1100 | None |
| B0S8G4 | 1569-1643 | None |
| T1E866 | 2-99 | None |
| A0A834INT5 | 214-318 | None |
| A0A182WBX4 | 54-156 | None |
| A0A2I0T674 | 41-116 | None |
| A0A1E1W801 | 15-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.