DPCstruct | MC1508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 333 ± 35 aa |
| Standard deviation of domain lengths | 35.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 35.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0044 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812KHC2 | 41-362 | NIFAGEAGYYEFAGYTGPSPDIEVRIGQTYTFDQTDPSNWYHAVGFAYYPDGAHGETWGADERDEVEGMGELLYKINGAATTCPDAG… |
| A0A6H5K2I2 | 1-303 | MVRGETYEFSQLEASNWYHPLGFAYYPDGAHAGVDELEEGIGSGDAPVYVIDGALSDLDTYEPQFFFPEETWLETNYTVELTVTDPD… |
| A0A1E7FM36 | 27-422 | None |
| D7FP23 | 10-320 | None |
| A0A7S0DZP4 | 1-257 | None |
| B7G4H8 | 33-390 | None |
| A0A7S3LM71 | 59-423 | None |
| A0A7S0IY28 | 3-308 | None |
| A0A7S0UD10 | 82-415 | None |
| A0A7S0XM02 | 44-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.