DPCstruct | MC15077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 229 |
|---|---|
| Mean domain length (aa) | 214 ± 36 aa |
| Standard deviation of domain lengths | 36.42 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01151 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D9P2S7 | 4-202 | FYMFLQTAAFVLVWTLVHRHVASHGPVAVARKAVMLNSWFYSLASAVLLGLMFVPQYEHAARRIYHLSKFYEDVDVLGVRAGGGEIE… |
| B0W2S4 | 8-231 | IGMIYAYLAWVLVVGPTYMRDRKPMQLTNTLFYYNLFQVALSAYMFYEHLMAGWARGYSWTCEPVDFSDGPLSRRMFNLCYVYYLSK… |
| A0A7R9KRY6 | 38-288 | None |
| A0A1D2NH43 | 13-280 | None |
| A0A0K0E4Q6 | 2-185 | None |
| A0A3Q0ILV5 | 20-221 | None |
| A0A6P5VRW2 | 2-201 | None |
| A0A162CZ02 | 40-291 | None |
| A0A7J6PHA4 | 266-506 | None |
| A0A2P8ZC19 | 11-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.