DPCstruct | MC15076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 155 ± 18 aa |
| Standard deviation of domain lengths | 18.16 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 41.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1GP11 | 305-437 | HLQPELQKVLAWLPTVWQHINRFLENHSSSDVTIGPRLFLSCPMDLKDSQVWFTDIWNYHLAPYIIEAVREGTQLYGRRGGAWNDPS… |
| B0W278 | 25-187 | MEPVKGFLGRYLRRKLFTLELSSGTVQPQLEKVLRWLPTVWQHINSFLETHNSSDVTIGPRLFLSCPMNLQDSQVWFTDVWNYHLAP… |
| A0A7R9KND7 | 2-158 | None |
| A0A310S989 | 854-1039 | None |
| A0A0N5ARJ6 | 240-383 | None |
| A0A1I8HBF8 | 18-144 | None |
| A0A7I4NLM6 | 1828-2001 | None |
| A0A158R3B1 | 359-485 | None |
| Q80TN7 | 2172-2350 | None |
| A0A2I0TND5 | 227-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.