DPCstruct | MC15073
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 8.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C4LEJ1 | 1-82 | MTCSALSNLRILMAETGGDPAAIKTRLADPKADHLGCTRVGRDRIEGNAERVVIGGTAYDCLKVKESSLCRWTVSGVPAEAP |
| B8IJC8 | 30-119 | AEKGKPALRRTAEPVLSCGALANLRLLMRDTRGDPAAIAALFADPKADHLGCAMTPADRIEGVADRVTIGGTPYSCLKVKDSAVCRW… |
| A0A1G5TEI9 | 2-67 | None |
| A0A519XHK5 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.