DPCstruct | MC15070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 72 ± 10 aa |
| Standard deviation of domain lengths | 10.23 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.98 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 63.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2KAS5 | 1-69 | MPRGDKDKYTEKQKRKAEHIEQSYEHKGLSKDEAESRAWATVNKQSGGGDKSGGSGSKTSSSEKKTARS |
| A0A0Q5Z2C5 | 1-79 | MPRGDKGKYTDKQVRKAEHIAESYEARGVPEAQAEARAWATVNKDDGGGKKPGGSGRAKVSTRTAEERSASARKGAATR |
| A0A3A8KLJ9 | 1-83 | None |
| A0A4Q6H0Q6 | 1-67 | None |
| F2A329 | 91-168 | None |
| A0A1Q4FH50 | 1-68 | None |
| A0A0U5JII5 | 1-63 | None |
| A0A2W5BCU7 | 38-102 | None |
| N9PW06 | 16-70 | None |
| B8L9Q1 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.