DPCstruct | MC1507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 324 ± 88 aa |
| Standard deviation of domain lengths | 88.13 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 76.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5JVQ3 | 5-495 | AAAAVNKAAGQRGVGVATAAADGADGGAAEGSKSSGSGSVRLRTFEEKLNQGEKKWWPWLYEVLVVQWTEVLATARGGMEEPGRRTG… |
| A0A0S7J8Y2 | 2-250 | TAILKPSTDFLTSNKLLKHSWYFFEALVKSMAYFLMESGKVKLSRNQRFSASFHHAVETLVNMLMPHITQKYKDNLDASRNANHSLA… |
| A0A452XCS5 | 388-814 | None |
| A0A452XCT6 | 1-433 | None |
| A0A183J9A1 | 96-464 | None |
| A0A6G0HI57 | 325-536 | None |
| A0A5K3EH79 | 236-606 | None |
| A0A6A4UYC5 | 1-353 | None |
| A0A2G8LHP3 | 57-375 | None |
| A0A0C2JK57 | 225-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.