DPCstruct | MC15069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 91 ± 6 aa |
| Standard deviation of domain lengths | 5.93 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E0NRH3 | 2-93 | KPPESIAAARVLAYASVSSCDFQGSNLFVDGVALGPVPRLAIAEDLQSGTTLLLRCGLDWSVLGLSGHPSAAAARSRAEREYRGSSS… |
| A0A841MVZ0 | 77-169 | PVPDLIGGAKTLFYTDIDSRHEKTDKTKHFIGGQQVNDISCLAICEYDNESGYYLFGCDSDWSTITDTFHDKIEDAKEQAESEYKNT… |
| A0A2S8EZL0 | 2-95 | None |
| S6A276 | 5-91 | None |
| A0A845X2Y1 | 9-94 | None |
| A0A0F0GXA7 | 80-161 | None |
| A0A4R8IIN6 | 3-95 | None |
| A0A654DYX3 | 98-202 | None |
| A0A7V3END2 | 2-100 | None |
| A0A1M5R5F3 | 137-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.