DPCstruct | MC15067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 140 ± 41 aa |
| Standard deviation of domain lengths | 41.43 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 85.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D7QN33 | 24-164 | AVSRRVDGLQPVIDIKGQPYFINVHFGLLEPANNFLIEPIRIGDIQMDQQTKKLSFYFDTSTKERVDIDEAITELPGNVVRVELPNL… |
| A0A841MCP8 | 3-139 | GFEERKKGHLPEVDIAGDRFLIDVRLAELRHVDTPWKRLPLDQMVPTEDHRHYQFFYNRELKSVFHASQELTDIPEHVVLVEIPDEM… |
| A0A3D2XHT2 | 5-119 | None |
| A0A1E4AF97 | 33-165 | None |
| A0A7X0CNI2 | 211-352 | None |
| A0A1E4AFT4 | 6-136 | None |
| A0A7Y4XT57 | 3-113 | None |
| A0A5C1ISX8 | 151-287 | None |
| A0A1G7JSX8 | 282-405 | None |
| A0A1M5RCE5 | 392-522 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.