DPCstruct | MC15062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 65 ± 9 aa |
| Standard deviation of domain lengths | 8.75 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 45.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17653 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0SVB5 | 131-209 | SGQNSGEASLCAGSEGLTEVEQKIVALHEEACAAGQDSYADPITGYLVFTRVAHLQRGHCCGSACRHCPYGQANVKDLS |
| A0A0N5C361 | 110-175 | EKLSKEERDIYMAHLKAIEDRALTYKDPKTGYIVMTVSQHLYKAKCCGNACRHCPYNQINATEEAK |
| A0A4W3I5Z2 | 37-109 | None |
| A0A654HRS9 | 26-88 | None |
| E9G6I8 | 82-160 | None |
| A0A1A8Z396 | 23-77 | None |
| A0A1G0SM67 | 2-58 | None |
| A0A7W2CCB2 | 14-64 | None |
| A0A0R3QMK1 | 496-558 | None |
| A0A7S0DMC1 | 59-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.