DPCstruct | MC15061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 204 ± 21 aa |
| Standard deviation of domain lengths | 20.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P9C4U7 | 217-417 | YPKTAIVPIKEAVPKSLTVTNLLEAQKSEPFCEAMENCFDTAIKEFTLEPQMVKENAKMILECNGTRKEFVSGKGENYIEVFWVDGQ… |
| A0A6J0SHK5 | 6-206 | PKQLPSTPLSVDSLLMVQKSLESGNREADEMARACLDHALREFPREPRQLQDNATLTVQVKGRERMVFVSGTGENKIAVSWLKRKTY… |
| A0A151N7E5 | 143-353 | None |
| A0A7J6B3Y2 | 112-308 | None |
| M7CK25 | 69-239 | None |
| A0A6I9YKY6 | 16-203 | None |
| A0A6J8D8R5 | 6-189 | None |
| A0A402FNB3 | 39-256 | None |
| A0A402FGV0 | 48-279 | None |
| A0A7D9EA66 | 14-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.