DPCstruct | MC1506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 203 ± 19 aa |
| Standard deviation of domain lengths | 18.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 50.33 |
| Pfam Score | 69.44 |
| Assigned Pfam label(s) | CL0344- PF12617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3DK25 | 73-281 | KLICGASFEDVVDIRNLSLVYTLAGVDCIDCAADASVVSAVNEGIEAAREIVPIRRPWVMISVNDDEDLHFRKAEFDPEDCPHDCSR… |
| A0A6H5JLS5 | 5-211 | FAPLAEQDLPAIRDLSLVYTLAGADCIDVAAEEAVIEAARDGVIAALGVAETIGKPMRMPWLMMSVNDDEEDPHFRKAAFDPNLCPA… |
| A0A7J7IIY8 | 89-324 | None |
| A0A7I4F4J4 | 137-371 | None |
| A0A834SLZ5 | 6-207 | None |
| A0A445IWE6 | 63-255 | None |
| A0A1T1D669 | 4-195 | None |
| A0A452Y2T5 | 77-298 | None |
| A0A2M7G483 | 15-212 | None |
| A0A5D3AB18 | 2-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.