DPCstruct | MC15059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 81 ± 5 aa |
| Standard deviation of domain lengths | 5.28 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 59.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05427 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3I7Q2 | 43-127 | RRQFDNVKHVFKTVEDMMGSLVENIRTLFLISEELAKKYAAIVFIANNRFETGKKKLHYLTFEDFAFCADQMMSHWTSRARGVKT |
| A0A6J0SES0 | 7-89 | QFDNFKRVFKAVEELRGSLVENIQQHFLLSDRLARDYAAIVFFANSRFETGKKKLQYLTFEDFAYCAEQMIQNWTLGAVGKSG |
| A0A226ETU8 | 138-217 | None |
| A0A674GYR3 | 312-392 | None |
| A0A674GU71 | 136-223 | None |
| A0A2K5C5U3 | 135-216 | None |
| A0A0V1HAM7 | 54-136 | None |
| A0A6A0GSW4 | 83-165 | None |
| A0A834A0L1 | 1-66 | None |
| A0A7F5QVL8 | 136-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.