DPCstruct | MC15058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 72 ± 7 aa |
| Standard deviation of domain lengths | 6.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 67.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 57.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0114 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822ZRI1 | 8-65 | SLDHLSPSEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPT |
| A0A2P2K9T0 | 1-64 | MSLDLASERVYYVHCNFCNTILAVSVPSSSLFTMVTVRCGHCANLLSVNMGASLPTVPLQDPQV |
| A0A287UDL0 | 17-92 | None |
| V4KXK1 | 1-72 | None |
| A0A2J6MFV8 | 2-81 | None |
| Q0WQ08 | 4-83 | None |
| A0A3B5ZUC2 | 9-84 | None |
| A0A2Z6P092 | 1-68 | None |
| A0A287FEV3 | 35-105 | None |
| A0A059C530 | 88-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.