DPCstruct | MC15056
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 70 ± 10 aa |
| Standard deviation of domain lengths | 9.87 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 57.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2J772 | 2-78 | ILDGVSKLEEALLVEPKKPDTIWCLGTAHTSYAFLTPDQAVATEYFEKATVYFQQAVDEVLFSLKTFHAGVVLYRNV |
| A0A103X801 | 127-187 | IQYTDVVSKLDEALAINPAKHEALWCLGNAHTANAFLTLDHDEAKIQFEQAFQCFEKAVEE |
| A0A804NHX7 | 3-75 | None |
| A0A2U1QKV0 | 4-80 | None |
| A0A103Y5N1 | 96-162 | None |
| A0A3S4Q232 | 212-271 | None |
| A0A833TFY8 | 2-62 | None |
| A0A804K1G2 | 57-146 | None |
| A0A371I9Z9 | 1-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.